NIFUN purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ISCU expression in transfected 293T cell line (H00023479-T01) by ISCU MaxPab polyclonal antibody.
Lane 1: NIFUN transfected lysate(15.62 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NIFUN protein.
Immunogen
NIFUN (NP_055116, 1 a.a. ~ 142 a.a) full-length human protein.
Sequence
MVLIDMSVDLSTQVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ISCU expression in transfected 293T cell line (H00023479-T01) by ISCU MaxPab polyclonal antibody.
Lane 1: NIFUN transfected lysate(15.62 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ISCU
Entrez GeneID
23479GeneBank Accession#
NM_014301Protein Accession#
NP_055116Gene Name
ISCU
Gene Alias
2310020H20Rik, HML, ISU2, MGC74517, NIFU, NIFUN, hnifU
Gene Description
iron-sulfur cluster scaffold homolog (E. coli)
Gene Ontology
HyperlinkGene Summary
Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria. [provided by RefSeq
Other Designations
IscU iron-sulfur cluster scaffold homolog|NifU-like N-terminal domain containing|iron-sulfur cluster assembly enzyme|nitrogen fixation cluster-like
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com