Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Disease

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL24 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00011009-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human IL24 protein.
  • Immunogen:
  • IL24 (NP_006841.1, 1 a.a. ~ 206 a.a) full-length human protein.
  • Sequence:
  • MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of IL24 expression in transfected 293T cell line (H00011009-T02) by IL24 MaxPab polyclonal antibody.

    Lane 1: IL24 transfected lysate(23.80 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • IL24
  • Gene Alias:
  • C49A,FISP,IL-24,IL10B,MDA7,Mob-5,ST16,mda-7
  • Gene Description:
  • interleukin 24
  • Gene Summary:
  • This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • IL-24 splice variant delE3,IL-24 splice variant delE5,OTTHUMP00000034620,melanoma differentiation association protein 7,suppression of tumorigenicity 16 (melanoma differentiation)
  • RSS
  • YouTube
  • Linkedin
  • Facebook