CBX1 monoclonal antibody (M01), clone 4E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CBX1 expression in transfected 293T cell line by CBX1 monoclonal antibody (M01), clone 4E12.
Lane 1: CBX1 transfected lysate(21.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CBX1 is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CBX1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CBX1.
Immunogen
CBX1 (NP_006798.1, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CBX1 expression in transfected 293T cell line by CBX1 monoclonal antibody (M01), clone 4E12.
Lane 1: CBX1 transfected lysate(21.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CBX1 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CBX1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CBX1
Entrez GeneID
10951GeneBank Accession#
NM_006807Protein Accession#
NP_006798.1Gene Name
CBX1
Gene Alias
CBX, HP1-BETA, HP1Hs-beta, HP1Hsbeta, M31, MOD1, p25beta
Gene Description
chromobox homolog 1 (HP1 beta homolog Drosophila )
Omim ID
604511Gene Ontology
HyperlinkGene Summary
This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
heterochromatin protein 1-beta|heterochromatin protein p25 beta|modifier 1 protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com