Product Browser

Last updated: 2022/10/2
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TOMM20 monoclonal antibody (M01), clone 4F3 

  • Catalog # : H00009804-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant TOMM20.
  • Immunogen:
  • TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009804-M01
    Western Blot detection against Immunogen (41.69 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • 3.
  • Microglia modulate blood flow, neurovascular coupling, and hypoperfusion via purinergic actions.
    Eszter Császár, Nikolett Lénárt, Csaba Cserép, Zsuzsanna Környei, Rebeka Fekete, Balázs Pósfai, Diána Balázsfi, Balázs Hangya, Anett D Schwarcz, Eszter Szabadit, Dávid Szöllősi, Krisztián Szigeti, Domokos Máthé, Brian L West, Katalin Sviatkó, Ana Rita Brás, Jean-Charles Mariani, Andrea Kliewer, Zsolt Lenkei, László Hricisák, Zoltán Benyó, Mária Baranyi, Beáta Sperlágh, Ákos Menyhárt, Eszter Farkas, Ádám Dénes.J Exp Med. 2022 Mar 7;219(3):e20211071. doi: 10.1084/jem.20211071. Epub 2022 Feb 24.
  • 4.
  • Metabolic impairment of non-small cell lung cancers by mitochondrial HSPD1 targeting.
    Beatrice Parma, Vignesh Ramesh, Paradesi Naidu Gollavilli, Aarif Siddiqui, Luisa Pinna, Annemarie Schwab, Sabine Marschall, Shuman Zhang, Christian Pilarsky, Francesca Napoli, Marco Volante, Sophia Urbanczyk, Dirk Mielenz, Henrik Daa Schrøder, Marc Stemmler, Heiko Wurdak, Paolo Ceppi.J Exp Clin Cancer Res. 2021 Aug 7;40(1):248. doi: 10.1186/s13046-021-02049-8.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • TOMM20 monoclonal antibody (M01), clone 4F3. Western Blot analysis of TOMM20 expression in human ovarian cancer.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TOMM20 monoclonal antibody (M01), clone 4F3 Western Blot analysis of TOMM20 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TOMM20 monoclonal antibody (M01), clone 4F3. Western Blot analysis of TOMM20 expression in PC-12 ( Cat # L012V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TOMM20 monoclonal antibody (M01), clone 4F3. Western Blot analysis of TOMM20 expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TOMM20 expression in transfected 293T cell line by TOMM20 monoclonal antibody (M01), clone 4F3.

    Lane 1: TOMM20 transfected lysate(16.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunofluorescence
  • Immunofluorescence enlargeenlarge this image
  • Immunofluorescence of monoclonal antibody to TOMM20 on HeLa cell. [antibody concentration 10 ug/ml]
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to TOMM20 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged TOMM20 is approximately 0.1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9804
  • Gene Name:
  • TOMM20
  • Gene Alias:
  • KIAA0016,MAS20,MGC117367,MOM19,TOM20
  • Gene Description:
  • translocase of outer mitochondrial membrane 20 homolog (yeast)
  • Other Designations:
  • OTTHUMP00000037593,translocase of outer mitochondrial membrane 20 homolog,translocase of outer mitochondrial membrane 20 homolog type II
  • RSS
  • YouTube
  • Linkedin
  • Facebook