TOMM20 monoclonal antibody (M01), clone 4F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TOMM20.
Immunogen
TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.69 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TOMM20 monoclonal antibody (M01), clone 4F3. Western Blot analysis of TOMM20 expression in human ovarian cancer.Western Blot (Cell lysate)
TOMM20 monoclonal antibody (M01), clone 4F3. Western Blot analysis of TOMM20 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
TOMM20 monoclonal antibody (M01), clone 4F3 Western Blot analysis of TOMM20 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
TOMM20 monoclonal antibody (M01), clone 4F3. Western Blot analysis of TOMM20 expression in NIH/3T3.Western Blot (Transfected lysate)
Western Blot analysis of TOMM20 expression in transfected 293T cell line by TOMM20 monoclonal antibody (M01), clone 4F3.
Lane 1: TOMM20 transfected lysate(16.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOMM20 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TOMM20 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TOMM20 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TOMM20
Entrez GeneID
9804GeneBank Accession#
BC066335Protein Accession#
AAH66335Gene Name
TOMM20
Gene Alias
KIAA0016, MAS20, MGC117367, MOM19, TOM20
Gene Description
translocase of outer mitochondrial membrane 20 homolog (yeast)
Omim ID
601848Gene Ontology
HyperlinkOther Designations
OTTHUMP00000037593|translocase of outer mitochondrial membrane 20 homolog|translocase of outer mitochondrial membrane 20 homolog type II
-
Interactome
-
Publication Reference
-
PRMT1 suppresses doxorubicin-induced cardiotoxicity by inhibiting endoplasmic reticulum stress.
Su Woo Kim, Byeong-Yun Ahn, Thi Thuy Vy Tran, Jung-Hoon Pyun, Jong-Sun Kang, Young-Eun Leem.
Cellular Signalling 2022 Jul; 98:110412.
Application:IF, Human, H2c2 cells.
-
Enriched Environment-Induced Neuroprotection against Cerebral Ischemia-Reperfusion Injury Might Be Mediated via Enhancing Autophagy Flux and Mitophagy Flux.
Qi-Qi Zhang, Lu Luo, Mei-Xi Liu, Chuan-Jie Wang, Yi Wu, Ke-Wei Yu.
Mediators of Inflammation 2022 Jun; 2022:2396487.
Application:IF, Mouse, Mouse brain.
-
Microglia modulate blood flow, neurovascular coupling, and hypoperfusion via purinergic actions.
Eszter Császár, Nikolett Lénárt, Csaba Cserép, Zsuzsanna Környei, Rebeka Fekete, Balázs Pósfai, Diána Balázsfi, Balázs Hangya, Anett D Schwarcz, Eszter Szabadit, Dávid Szöllősi, Krisztián Szigeti, Domokos Máthé, Brian L West, Katalin Sviatkó, Ana Rita Brás, Jean-Charles Mariani, Andrea Kliewer, Zsolt Lenkei, László Hricisák, Zoltán Benyó, Mária Baranyi, Beáta Sperlágh, Ákos Menyhárt, Eszter Farkas, Ádám Dénes.
The Journal of Experimental Medicine 2022 Mar; 219(3):e20211071.
Application:IF, Mouse, Mouse brain.
-
Metabolic impairment of non-small cell lung cancers by mitochondrial HSPD1 targeting.
Beatrice Parma, Vignesh Ramesh, Paradesi Naidu Gollavilli, Aarif Siddiqui, Luisa Pinna, Annemarie Schwab, Sabine Marschall, Shuman Zhang, Christian Pilarsky, Francesca Napoli, Marco Volante, Sophia Urbanczyk, Dirk Mielenz, Henrik Daa Schrøder, Marc Stemmler, Heiko Wurdak, Paolo Ceppi.
Journal of Experimental & Clinical Cancer Research 2021 Aug; 40(1):248.
Application:WB-Ce, Human, A-549, H460, H1299 cells.
-
Mechanisms of impaired mitochondrial homeostasis and NAD + metabolism in a model of mitochondrial heart disease exhibiting redox active iron accumulation.
Shannon Chiang, Nady Braidy, Sanaz Maleki, Sean Lal, Des R Richardson, Michael L-H Huang.
Redox Biology 2021 Oct; 46:102038.
Application:WB-Ti, WB-Tr, Mouse, Mouse heart.
-
The CD36 Ligand-Promoted Autophagy Protects Retinal Pigment Epithelial Cells from Oxidative Stress.
Marie-France Dorion, Mukandila Mulumba, Shuya Kasai, Ken Itoh, William D Lubell, Huy Ong.
Oxidative Medicine and Cellular Longevity 2021 Mar; 2021:6691402.
Application:IF, Human, RPE-1 cells.
-
Therapeutic effects of non-saponin fraction with rich polysaccharide from Korean red ginseng on aging and Alzheimer's disease.
Soo Jung Shin, Yunkwon Nam, Yong Ho Park, Min-Jeong Kim, Eunbeen Lee, Seong Gak Jeon, Bong-Seok Bae, Jiho Seo, Sung-Lye Shim, Jong-Seok Kim, Chang-Kyun Han, Sujin Kim, Yong Yook Lee, Minho Moon.
Free Radical Biology & Medicine 2021 Feb; 164:233.
Application:IF, IHC-Fr, Mouse, Mouse brain.
-
CRISPR-Mediated Induction of Neuron-Enriched Mitochondrial Proteins Boosts Direct Glia-to-Neuron Conversion.
Gianluca L Russo, Giovanna Sonsalla, Poornemaa Natarajan, Christopher T Breunig, Giorgia Bulli, Juliane Merl-Pham, Sabine Schmitt, Jessica Giehrl-Schwab, Florian Giesert, Martin Jastroch, Hans Zischka, Wolfgang Wurst, Stefan H Stricker, Stefanie M Hauck, Giacomo Masserdotti, Magdalena Götz.
Cell Stem Cell 2021 Mar; 28(3):524.
Application:IF, Mouse , Mouse astrocytes.
-
Codon optimization is an essential parameter for the efficient allotopic expression of mtDNA genes.
Lewis CJ, Dixit B, Batiuk E, Hall CJ, O'Connor MS, Boominathan A.
Redox Biology 2020 Feb; 30:101429.
Application:WB-Tr, Human, HEK 293 cells.
-
Accumulation of damaged mitochondria in alveolar macrophages with reduced OXPHOS related gene expression in IPF.
Tsitoura E, Vasarmidi E, Bibaki E, Trachalaki A, Koutoulaki C, Papastratigakis G, Papadogiorgaki S, Chalepakis G, Tzanakis N, Antoniou KM.
Respiratory Research 2019 Nov; 20(1):264.
Application:IF, WB-Ce, Human, Alveolar macrophages, Bronchoalveolar lavage cells.
-
Mitophagy in Refractory Temporal Lobe Epilepsy Patients with Hippocampal Sclerosis.
Wu M, Liu X, Chi X, Zhang L, Xiong W, Chiang SM, Zhou D, Li J.
Amino Acids 2018 Mar; 38(2):479.
Application:IF, IHC-P, Human, Brain from patients with Hippocampal Sclerosis.
-
Mitotic redistribution of the mitochondrial network by Miro and Cenp-F.
Kanfer G, Thibault Courthéoux T, Martin Peterka M, Sonja Meier S, Soste M, Melnik A, Reis K, Aspenström P, Peter M, Picotti P, Kornmann B.
Nature Communications 2016 Aug; 6:8015.
Application:IF, Human, U2OS cells.
-
Short RNA molecules with high binding affinity to the KH motif of A-kinase anchoring protein 1 (AKAP1): implications for the regulation of steroidogenesis.
Grozdanov PN, Stocco DM.
Molecular Endocrinology 2012 Dec; 26(12):2104.
Application:IF, Human, H295R cells.
-
Cellular distribution and subcellular localization of spatacsin and spastizin, two proteins involved in hereditary spastic paraplegia.
Murmu RP, Martin E, Rastetter A, Esteves T, Muriel MP, El Hachimi KH, Denora PS, Dauphin A, Fernandez JC, Duyckaerts C, Brice A, Darios F, Stevanin G.
Molecular and Cellular Neurosciences 2011 Jul; 47(3):191.
Application:IF, Human, SH-SY5Y cells.
-
PRMT1 suppresses doxorubicin-induced cardiotoxicity by inhibiting endoplasmic reticulum stress.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com