TOMM20 monoclonal antibody (M01J), clone 4F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant TOMM20.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Host
Mouse
Reactivity
Human, Mouse, Rat
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.69 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TOMM20 monoclonal antibody (M01J), clone 4F3. Western Blot analysis of TOMM20 expression in rat brain.Western Blot (Tissue lysate)
TOMM20 monoclonal antibody (M01J), clone 4F3. Western Blot analysis of TOMM20 expression in human ovarian cancer.Western Blot (Cell lysate)
TOMM20 monoclonal antibody (M01J), clone 4F3. Western Blot analysis of TOMM20 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of TOMM20 expression in transfected 293T cell line by TOMM20 monoclonal antibody (M01J), clone 4F3.
Lane 1: TOMM20 transfected lysate (Predicted MW: 16.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TOMM20 on formalin-fixed paraffin-embedded human small intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TOMM20 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TOMM20 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TOMM20
Entrez GeneID
9804GeneBank Accession#
BC066335Protein Accession#
AAH66335Gene Name
TOMM20
Gene Alias
KIAA0016, MAS20, MGC117367, MOM19, TOM20
Gene Description
translocase of outer mitochondrial membrane 20 homolog (yeast)
Omim ID
601848Gene Ontology
HyperlinkOther Designations
OTTHUMP00000037593|translocase of outer mitochondrial membrane 20 homolog|translocase of outer mitochondrial membrane 20 homolog type II
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com