RRM2 monoclonal antibody (M01J), clone 1E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RRM2.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RRM2 monoclonal antibody (M01J), clone 1E1. Western Blot analysis of RRM2 expression in HepG2.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RRM2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]Immunoprecipitation
Immunoprecipitation of RRM2 transfected lysate using anti-RRM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RRM2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RRM2 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RRM2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RRM2
Entrez GeneID
6241GeneBank Accession#
NM_001034Protein Accession#
NP_001025Gene Name
RRM2
Gene Alias
R2, RR2M
Gene Description
ribonucleotide reductase M2 polypeptide
Omim ID
180390Gene Ontology
HyperlinkGene Summary
This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq
Other Designations
ribonucleotide reductase M2 subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com