RRM2 monoclonal antibody (M01), clone 1E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RRM2.
Immunogen
RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RRM2 monoclonal antibody (M01), clone 1E1. Western Blot analysis of RRM2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RRM2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]Immunoprecipitation
Immunoprecipitation of RRM2 transfected lysate using anti-RRM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RRM2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RRM2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RRM2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RRM2
Entrez GeneID
6241GeneBank Accession#
NM_001034Protein Accession#
NP_001025Gene Name
RRM2
Gene Alias
R2, RR2M
Gene Description
ribonucleotide reductase M2 polypeptide
Omim ID
180390Gene Ontology
HyperlinkGene Summary
This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq
Other Designations
ribonucleotide reductase M2 subunit
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
APLP2, RRM2 and PRC1: new putative markers for the differential diagnosis of thyroid follicular lesions.
Castelblanco E, Zafón C, Maravall J, Gallel P, Martinez M, Capel I, Bella-Cueto MR, Halperin I, Temprana-Salvador J, Iglesias C, Puig-Domingo M, Robledo M, Matias-Guiu X, Mauricio D.
Thyroid : Official Journal of the American Thyroid Association 2017 Jan; 27(1):59.
Application:IHC-P, Human, Human follicular carcinoma, Human follicular adenoma, Human nodular hyperplasia.
-
RRM1 maintains centrosomal integrity via CHK1 and CDK1 signaling during replication stress.
Kim SH, Park ER, Joo HY, Shen YN, Hong SH, Kim CH, Singh R, Lee KH, Shin HJ.
Cancer Letters 2014 May; 346(2):249.
Application:WB-Tr, Human, HeLa cells.
-
KRAS-mediated Up-regulation of RRM2 Expression Is Essential for the Proliferation of Colorectal Cancer Cell Lines.
Yoshida Y, Tsunoda T, Doi K, Tanaka Y, Fujimoto T, Machida T, Ota T, Koyanagi M, Takashima Y, Sasazuki T, Kuroki M, Iwasaki A, Shirasawa S.
Anticancer Research 2011 Jul; 31(7):2535.
Application:WB-Ce, WB-Tr, Human, HCT116, HKe3 cells.
-
Epstein-Barr virus episome stability is coupled to a delay in replication timing.
Zhou J, Snyder A, Lieberman PM.
Journal of Virology 2008 Dec; 83(5):2154.
Application:WB-Tr, EBV+ adherent cells, D98/HR1 cells.
-
Quantitative phosphoproteome profiling of Wnt3a mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine-20 in canonical Wnt signal transduction.
Tang LY, Deng N, Wang LS, Dai J, Wang ZL, Jiang XS, Li SJ, Li L, Sheng QH, Wu DQ, Li L, Zeng R.
Molecular & Cellular Proteomics 2007 Aug; 6(11):1952.
Application:WB, Human, HEK 293 cells.
-
APLP2, RRM2 and PRC1: new putative markers for the differential diagnosis of thyroid follicular lesions.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com