PAFAH1B3 monoclonal antibody (M08), clone 3G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in IMR-32 ( Cat # L008V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAFAH1B3 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (51.15 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B3.
Immunogen
PAFAH1B3 (AAH03016, 1 a.a. ~ 231 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.15 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
PAFAH1B3 monoclonal antibody (M08), clone 3G6. Western Blot analysis of PAFAH1B3 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAFAH1B3 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — PAFAH1B3
Entrez GeneID
5050GeneBank Accession#
BC003016Protein Accession#
AAH03016Gene Name
PAFAH1B3
Gene Alias
-
Gene Description
platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
Omim ID
603074Gene Ontology
HyperlinkGene Summary
This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com