PAFAH1B3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PAFAH1B3 protein.
Immunogen
PAFAH1B3 (NP_002564.1, 1 a.a. ~ 231 a.a) full-length human protein.
Sequence
MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PAFAH1B3 MaxPab polyclonal antibody. Western Blot analysis of PAFAH1B3 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of PAFAH1B3 expression in transfected 293T cell line (H00005050-T01) by PAFAH1B3 MaxPab polyclonal antibody.
Lane 1: PAFAH1B3 transfected lysate(25.41 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PAFAH1B3
Entrez GeneID
5050GeneBank Accession#
NM_002573Protein Accession#
NP_002564.1Gene Name
PAFAH1B3
Gene Alias
-
Gene Description
platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
Omim ID
603074Gene Ontology
HyperlinkGene Summary
This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com