PAFAH1B3 monoclonal antibody (M02), clone 8C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PAFAH1B3.
Immunogen
PAFAH1B3 (AAH03016, 1 a.a. ~ 231 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.15 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PAFAH1B3 monoclonal antibody (M02), clone 8C11. Western Blot analysis of PAFAH1B3 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
PAFAH1B3 monoclonal antibody (M02), clone 8C11 Western Blot analysis of PAFAH1B3 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Cell lysate)
PAFAH1B3 monoclonal antibody (M02), clone 8C11. Western Blot analysis of PAFAH1B3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PAFAH1B3 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PAFAH1B3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PAFAH1B3
Entrez GeneID
5050GeneBank Accession#
BC003016Protein Accession#
AAH03016Gene Name
PAFAH1B3
Gene Alias
-
Gene Description
platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
Omim ID
603074Gene Ontology
HyperlinkGene Summary
This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with mental retardation, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD)
-
Interactome
-
Pathway
-
Publication Reference
-
Loss of PAFAH1B2 Reduces Amyloid-β Generation by Promoting the Degradation of Amyloid Precursor Protein C-Terminal Fragments.
Page RM, Munch A, Horn T, Kuhn PH, Colombo A, Reiner O, Boutros M, Steiner H, Lichtenthaler SF, Haass C.
Journal of Neurology 2012 Dec; 32(50):18204.
Application:WB-Ce, Mouse, Mouse embryonic fibroblast.
-
Loss of PAFAH1B2 Reduces Amyloid-β Generation by Promoting the Degradation of Amyloid Precursor Protein C-Terminal Fragments.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com