MYL2 monoclonal antibody (M01), clone 3B9-B4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunoprecipitation
Immunoprecipitation of MYL2 transfected lysate using anti-MYL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MYL2 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYL2 is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to MYL2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (44 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant MYL2.
Immunogen
MYL2 (AAH15821.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of MYL2 transfected lysate using anti-MYL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MYL2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MYL2 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MYL2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — MYL2
Entrez GeneID
4633GeneBank Accession#
BC015821Protein Accession#
AAH15821.1Gene Name
MYL2
Gene Alias
CMH10, DKFZp779C0562, MLC2
Gene Description
myosin, light chain 2, regulatory, cardiac, slow
Gene Ontology
HyperlinkGene Summary
Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq
Other Designations
RLC of myosin|cardiac ventricular myosin light chain 2|myosin light chain 2|myosin regulatory light chain 2, ventricular/cardiac muscle isoform|myosin, light polypeptide 2, regulatory, cardiac, slow|regulatory light chain of myosin|slow cardiac myosin reg
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Drastic increase of myosin light chain MLC-2 in senescent skeletal muscle indicates fast-to-slow fibre transition in sarcopenia of old age.
Gannon J, Doran P, Kirwan A, Ohlendieck K.
European Journal of Cell Biology 2009 Nov; 88(11):685.
Application：IF, Rat, Muscle.
-
Drastic increase of myosin light chain MLC-2 in senescent skeletal muscle indicates fast-to-slow fibre transition in sarcopenia of old age.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com