Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MYL2 monoclonal antibody (M01), clone 3B9-B4

  • Catalog # : H00004633-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant MYL2.
  • Immunogen:
  • MYL2 (AAH15821.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004633-M01
    Western Blot detection against Immunogen (44 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of MYL2 transfected lysate using anti-MYL2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MYL2 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged MYL2 is 0.03 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4633
  • Gene Name:
  • MYL2
  • Gene Alias:
  • CMH10,DKFZp779C0562,MLC2
  • Gene Description:
  • myosin, light chain 2, regulatory, cardiac, slow
  • Gene Summary:
  • Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq
  • Other Designations:
  • RLC of myosin,cardiac ventricular myosin light chain 2,myosin light chain 2,myosin regulatory light chain 2, ventricular/cardiac muscle isoform,myosin, light polypeptide 2, regulatory, cardiac, slow,regulatory light chain of myosin,slow cardiac myosin reg
  • RSS
  • YouTube
  • Linkedin
  • Facebook