BUB1B monoclonal antibody (M02), clone 2G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BUB1B.
Immunogen
BUB1B (AAH18739, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.93 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BUB1B monoclonal antibody (M02), clone 2G5 Western Blot analysis of BUB1B expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of BUB1B expression in transfected 293T cell line by BUB1B monoclonal antibody (M02), clone 2G5.
Lane 1: BUB1B transfected lysate(119.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BUB1B is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of BUB1B over-expressed 293 cell line, cotransfected with BUB1B Validated Chimera RNAi ( Cat # H00000701-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with BUB1B monoclonal antibody (M02) clone 2G5 (Cat # H00000701-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDC20 and BUB1B. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-BUB1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — BUB1B
Entrez GeneID
701GeneBank Accession#
BC018739Protein Accession#
AAH18739Gene Name
BUB1B
Gene Alias
BUB1beta, BUBR1, Bub1A, MAD3L, SSK1, hBUBR1
Gene Description
budding uninhibited by benzimidazoles 1 homolog beta (yeast)
Gene Ontology
HyperlinkGene Summary
This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq
Other Designations
BUB1 budding uninhibited by benzimidazoles 1 homolog beta|MAD3/BUB1-related protein kinase|budding uninhibited by benzimidazoles 1, beta
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Prognostic implications of securin expression and sub-cellular localization in human breast cancer.
Gurvits N, Repo H, Loyttyniemi E, Nykanen M, Anttinen J, Kuopio T, Talvinen K, Kronqvist P.
Cellular Oncology (Dordrecht) 2016 Mar; 39(4):319.
Application:IHC, IF, Human, Benign breast epithelium and in invasive breast carcinomas.
-
Prognostic implications of securin expression and sub-cellular localization in human breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com