BUB1B monoclonal antibody (M02J), clone 2G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
BUB1B monoclonal antibody (M02J), clone 2G5. Western Blot analysis of BUB1B expression in Hela S3 NE.
Western Blot (Transfected lysate)
Western Blot analysis of BUB1B expression in transfected 293T cell line by BUB1B monoclonal antibody (M02J), clone 2G5.
Lane 1: BUB1B transfected lysate (Predicted MW: 119.5 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BUB1B is 0.3 ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of BUB1B over-expressed 293 cell line, cotransfected with BUB1B Validated Chimera RNAi ( Cat # H00000701-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with BUB1B monoclonal antibody (M02) clone 2G5 (Cat # H00000701-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDC20 and BUB1B. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-BUB1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (39.93 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BUB1B.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
BUB1B (AAH18739, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82)
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.93 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BUB1B monoclonal antibody (M02J), clone 2G5. Western Blot analysis of BUB1B expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of BUB1B expression in transfected 293T cell line by BUB1B monoclonal antibody (M02J), clone 2G5.
Lane 1: BUB1B transfected lysate (Predicted MW: 119.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BUB1B is 0.3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of BUB1B over-expressed 293 cell line, cotransfected with BUB1B Validated Chimera RNAi ( Cat # H00000701-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with BUB1B monoclonal antibody (M02) clone 2G5 (Cat # H00000701-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDC20 and BUB1B. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-BUB1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — BUB1B
Entrez GeneID
701GeneBank Accession#
BC018739Protein Accession#
AAH18739Gene Name
BUB1B
Gene Alias
BUB1beta, BUBR1, Bub1A, MAD3L, SSK1, hBUBR1
Gene Description
budding uninhibited by benzimidazoles 1 homolog beta (yeast)
Gene Ontology
HyperlinkGene Summary
This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq
Other Designations
BUB1 budding uninhibited by benzimidazoles 1 homolog beta|MAD3/BUB1-related protein kinase|budding uninhibited by benzimidazoles 1, beta
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com