Product Browser
 
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

TGFB1 (Human) Recombinant Protein   BioActive

  • Catalog # : P4576
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 5 ug
  • USD $ 259
  • Stock Image
  • order now, ship in 5 days
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Human TGFB1 (P01137) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
  • Theoretical MW (kDa):
  • 25
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.01 ng/ug or < 0.1 EU/ug.
  • Activity:
  • The activity is determined by the dose-dependent inhibition of IL-4-induced proliferation of mouse HT-2 cells. The expected ED50 for this effect is 0.1-0.15 ng/mL.
  • Storage Buffer:
  • Lyophilized with 10 mM HCl, 50 ug BSA per mg/mL of protein.
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Serial dilutions of Human TGFB1 (starting at 10 ng/mL) were added to HT-2 cultured with IL-4. Cell proliferation was measured and the linear portion of the curve was us used to calculate the ED50.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7040
  • Gene Name:
  • TGFB1
  • Gene Alias:
  • CED,DPD1,TGFB,TGFbeta
  • Gene Description:
  • transforming growth factor, beta 1
  • Gene Summary:
  • TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. TGFB acts synergistically with TGFA (MIM 190170) in inducing transformation. It also acts as a negative autocrine growth factor. Dysregulation of TGFB activation and signaling may result in apoptosis. Many cells synthesize TGFB and almost all of them have specific receptors for this peptide. TGFB1, TGFB2 (MIM 190220), and TGFB3 (MIM 190230) all function through the same receptor signaling systems.[supplied by OMIM
  • Other Designations:
  • TGF-beta 1 protein,diaphyseal dysplasia 1, progressive,transforming growth factor-beta 1
  • Interactome
  • Related Disease
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!