MAP1LC3A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MAP1LC3A expression in transfected 293T cell line (H00084557-T01) by MAP1LC3A MaxPab polyclonal antibody.
Lane 1: MAP1LC3A transfected lysate(13.31 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MAP1LC3A protein.
Immunogen
MAP1LC3A (AAH15810.1, 1 a.a. ~ 121 a.a) full-length human protein.
Sequence
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAP1LC3A expression in transfected 293T cell line (H00084557-T01) by MAP1LC3A MaxPab polyclonal antibody.
Lane 1: MAP1LC3A transfected lysate(13.31 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MAP1LC3A
Entrez GeneID
84557GeneBank Accession#
BC015810.1Protein Accession#
AAH15810.1Gene Name
MAP1LC3A
Gene Alias
LC3, LC3A, MAP1ALC3, MAP1BLC3
Gene Description
microtubule-associated protein 1 light chain 3 alpha
Omim ID
601242Gene Ontology
HyperlinkGene Summary
MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
MAP1 light chain 3-like protein 1|MAP1A/1B light chain 3 A|MAP1A/MAP1B LC3 A|OTTHUMP00000030696|OTTHUMP00000030697|OTTHUMP00000030698|microtubule-associated proteins 1A/1B light chain 3
-
Interactome
-
Publication Reference
-
CD5L is upregulated in hepatocellular carcinoma and promotes liver cancer cell proliferation and antiapoptotic responses by binding to HSPA5 (GRP78).
Aran G, Sanjurjo L, Bárcena C, Simon-Coma M, Téllez É, Vázquez-Vitali M, Garrido M, Guerra L, Díaz E, Ojanguren I, Elortza F, Planas R, Sala M, Armengol C, Sarrias MR.
FASEB Journal 2018 Feb; fj20170094.
Application：WB-Ce, Human, Huh7 cells.
-
CD5L is upregulated in hepatocellular carcinoma and promotes liver cancer cell proliferation and antiapoptotic responses by binding to HSPA5 (GRP78).
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com