- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Application
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Membrane > Transporter > TOMM20 monoclonal antibody (M01), clone 4F3
TOMM20 monoclonal antibody (M01), clone 4F3
- Catalog # : H00009804-M01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a full length recombinant TOMM20.
- Immunogen:
- TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
- Host:
- Mouse
- Reactivity:
- Human, Mouse, Rat
- Isotype:
- IgG1 Kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.69 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Publication Reference
- 1.
- Short RNA Molecules with High Binding Affinity to the KH Motif of A-Kinase Anchoring Protein 1 (AKAP1): Implications for the Regulation of Steroidogenesis.
Grozdanov PN, Stocco DM.Mol Endocrinol. 2012 Oct 17. [Epub ahead of print]
- 2.
- Cellular distribution and subcellular localization of spatacsin and spastizin, two proteins involved in hereditary spastic paraplegia.
Murmu RP, Martin E, Rastetter A, Esteves T, Muriel MP, El Hachimi KH, Denora PS, Dauphin A, Fernandez JC, Duyckaerts C, Brice A, Darios F, Stevanin G.Mol Cell Neurosci. 2011 Apr 27. [Epub ahead of print]
- Applications
- Western Blot (Cell lysate)
- TOMM20 monoclonal antibody (M01), clone 4F3 Western Blot analysis of TOMM20 expression in HeLa ( Cat # L013V1 ).
- Protocol Download
- Western Blot (Cell lysate)
- TOMM20 monoclonal antibody (M01), clone 4F3. Western Blot analysis of TOMM20 expression in PC-12 ( Cat # L012V1 ).
- Protocol Download
- Western Blot (Cell lysate)
- TOMM20 monoclonal antibody (M01), clone 4F3. Western Blot analysis of TOMM20 expression in NIH/3T3 ( Cat # L018V1 ).
- Protocol Download
- Western Blot (Transfected lysate)
- Western Blot analysis of TOMM20 expression in transfected 293T cell line by TOMM20 monoclonal antibody (M01), clone 4F3.
Lane 1: TOMM20 transfected lysate(16.3 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
enlarge this image- Immunoperoxidase of monoclonal antibody to TOMM20 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Protocol Download
- Immunofluorescence
enlarge this image- Immunofluorescence of monoclonal antibody to TOMM20 on HeLa cell. [antibody concentration 10 ug/ml]
- Protocol Download
- Sandwich ELISA (Recombinant protein)
- Detection limit for recombinant GST tagged TOMM20 is approximately 0.1ng/ml as a capture antibody.
- Protocol Download
- Application Image
- Western Blot (Cell lysate)
- enlarge
- Western Blot (Cell lysate)
- enlarge
- Western Blot (Cell lysate)
- enlarge
- Western Blot (Transfected lysate)
- enlarge
- Western Blot (Recombinant protein)
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- enlarge
- Immunofluorescence
- enlarge
- Sandwich ELISA (Recombinant protein)
- enlarge
- ELISA
- Entrez GeneID:
- 9804
- GeneBank Accession#:
- BC066335
- Protein Accession#:
- AAH66335
- Gene Name:
- TOMM20
- Gene Alias:
- KIAA0016,MAS20,MGC117367,MOM19,TOM20
- Gene Description:
- translocase of outer mitochondrial membrane 20 homolog (yeast)
- Omim ID:
- 601848
- Gene Ontology:
- Hyperlink
- Other Designations:
- OTTHUMP00000037593,translocase of outer mitochondrial membrane 20 homolog,translocase of outer mitochondrial membrane 20 homolog type II
