HSPB1 monoclonal antibody (M04), clone 3G3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HSPB1.
Immunogen
HSPB1 (NP_001531, 96 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HSPB1 expression in transfected 293T cell line by HSPB1 monoclonal antibody (M04), clone 3G3.
Lane 1: HSPB1 transfected lysate(22.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of HSPB1 transfected lysate using anti-HSPB1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HSPB1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HSPB1 is approximately 0.1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between AKT1 and HSPB1. Mahlavu cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-HSPB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to HSPB1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — HSPB1
Entrez GeneID
3315GeneBank Accession#
NM_001540Protein Accession#
NP_001531Gene Name
HSPB1
Gene Alias
CMT2F, DKFZp586P1322, HMN2B, HS.76067, HSP27, HSP28, Hsp25, SRP27
Gene Description
heat shock 27kDa protein 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is induced by environmental stress and developmental changes. The encoded protein is involved in stress resistance and actin organization and translocates from the cytoplasm to the nucleus upon stress induction. Defects in this gene are a cause of Charcot-Marie-Tooth disease type 2F (CMT2F) and distal hereditary motor neuropathy (dHMN). [provided by RefSeq
Other Designations
OTTHUMP00000024846|estrogen-regulated 24 kDa protein|heat shock 27kD protein 1|heat shock protein beta-1|stress-responsive protein 27
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com