ARHGEF18 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with ARHGEF18 polyclonal antibody (Cat # PAB23969) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with ARHGEF18 polyclonal antibody (Cat # PAB23969) shows moderate cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with ARHGEF18 polyclonal antibody (Cat # PAB23969) at 1-4 ug/mL dilution shows positivity in plasma membrane and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant ARHGEF18.
Immunogen
Recombinant protein corresponding to amino acids of human ARHGEF18.
Sequence
RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with ARHGEF18 polyclonal antibody (Cat # PAB23969) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human duodenum with ARHGEF18 polyclonal antibody (Cat # PAB23969) shows moderate cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with ARHGEF18 polyclonal antibody (Cat # PAB23969) at 1-4 ug/mL dilution shows positivity in plasma membrane and cytoplasm. -
Gene Info — ARHGEF18
Entrez GeneID
23370Protein Accession#
Q6ZSZ5Gene Name
ARHGEF18
Gene Alias
KIAA0521, MGC15913, P114-RhoGEF
Gene Description
rho/rac guanine nucleotide exchange factor (GEF) 18
Gene Ontology
HyperlinkGene Summary
Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
P114-RHO-GEF|Rho-specific guanine nucleotide exchange factor p114
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com