ARHGEF18 monoclonal antibody (M01), clone 8H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARHGEF18 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.8 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ARHGEF18.
Immunogen
ARHGEF18 (AAH08016.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (33); Rat (42)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.8 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ARHGEF18 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — ARHGEF18
Entrez GeneID
23370GeneBank Accession#
BC008016.1Protein Accession#
AAH08016.1Gene Name
ARHGEF18
Gene Alias
KIAA0521, MGC15913, P114-RhoGEF
Gene Description
rho/rac guanine nucleotide exchange factor (GEF) 18
Gene Ontology
HyperlinkGene Summary
Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
P114-RHO-GEF|Rho-specific guanine nucleotide exchange factor p114
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com