FGF21 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FGF21 full-length ORF ( AAH18404, 30 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.54
Interspecies Antigen Sequence
Mouse (79); Rat (79)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FGF21
Entrez GeneID
26291GeneBank Accession#
BC018404Protein Accession#
AAH18404Gene Name
FGF21
Gene Alias
-
Gene Description
fibroblast growth factor 21
Omim ID
609436Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Publication Reference
-
Fibroblast growth factor 21 protects against pathological cardiac remodeling by modulating galectin-3 expression.
Sun M, Jin L, Bai Y, Wang L, Zhao S, Ma C, Ma D.
Journal of Cellular Biochemistry 2019 Jul; [Epub].
Application:Func, Mouse, H9c2 cardiomyocytes.
-
Fibroblast growth factor 21 protects against pathological cardiac remodeling by modulating galectin-3 expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com