ACADVL monoclonal antibody (M01), clone 5D3

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACADVL.
Immunogen
ACADVL (NP_000009, 345 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (89)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACADVL monoclonal antibody (M01), clone 5D3 Western Blot analysis of ACADVL expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACADVL on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACADVL is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — ACADVL
Entrez GeneID
37GeneBank Accession#
NM_000018Protein Accession#
NP_000009Gene Name
ACADVL
Gene Alias
ACAD6, LCACD, VLCAD
Gene Description
acyl-Coenzyme A dehydrogenase, very long chain
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
-
-
Interactomes
-
Pathways
-
Publication Reference
-
ACAD9, a complex I assembly factor with a moonlighting function in fatty acid oxidation deficiencies.
Nouws J, Te Brinke H, Nijtmans LG, Houten SM.
Human Molecular Genetics 2014 Mar; 23(5):1311.
Application:WB-Tr, Human, Fibroblast cells.
-
Mild mitochondrial uncoupling does not affect mitochondrial biogenesis but downregulates pyruvate carboxylase in adipocytes: role for triglyceride content reduction.
De Pauw A, Demine S, Tejerina S, Dieu M, Delaive E, Kel A, Renard P, Raes M, Arnould T.
American Journal of Physiology. Endocrinology and Metabolism 2012 May; 302(9):E1123.
Application:WB, Mouse, 3T3-L1 preadipocytes.
-
ACAD9, a complex I assembly factor with a moonlighting function in fatty acid oxidation deficiencies.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com