ITGB2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western Blot analysis of Lane 1: RT-4 cell, Lane 2: U-251 MG sp cell, Lane 3: human plasma tissue (IgG/HSA depleted), Lane 4: human liver tissue and Lane 5: human tonsil tissue lysates with ITGB2 polyclonal antibody (Cat # PAB31467).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human spleen with ITGB2 polyclonal antibody (Cat # PAB31467) shows strong cytoplasmic positivity in cells in red pulp.
Immunofluorescence
Immunofluorescent staining of U-2 OS cells with ITGB2 polyclonal antibody (Cat # PAB31467) (Green) shows localization to cytosol.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ITGB2.
Immunogen
Recombinant protein corresponding to human ITGB2.
Sequence
LEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western Blot analysis of Lane 1: RT-4 cell, Lane 2: U-251 MG sp cell, Lane 3: human plasma tissue (IgG/HSA depleted), Lane 4: human liver tissue and Lane 5: human tonsil tissue lysates with ITGB2 polyclonal antibody (Cat # PAB31467).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human spleen with ITGB2 polyclonal antibody (Cat # PAB31467) shows strong cytoplasmic positivity in cells in red pulp.Immunofluorescence
Immunofluorescent staining of U-2 OS cells with ITGB2 polyclonal antibody (Cat # PAB31467) (Green) shows localization to cytosol. -
Gene Info — ITGB2
Entrez GeneID
3689Protein Accession#
P05107Gene Name
ITGB2
Gene Alias
CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7
Gene Description
integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the integrin beta chain family of proteins. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. This gene encodes the integrin beta chain beta 2. A given chain may combine with multiple partners resulting in different integrins. For example, beta 2 combines with the alpha L chain to form the integrin LFA-1, and combines with the alpha M chain to form the integrin Mac-1. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Defects in this gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
CD18 subunit|OTTHUMP00000115278|OTTHUMP00000115279|OTTHUMP00000115281|OTTHUMP00000115282|beta 2 integrin subunit|cell surface adhesion glycoprotein LFA-1/CR3/P150,959 beta subunit precursor)|complement receptor C3 beta-subunit|integrin beta 2|integrin bet
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com