ITGA6 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ITGA6.
Immunogen
Recombinant protein corresponding to human ITGA6.
Sequence
APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
Host
Rabbit
Reactivity
Human, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Wistar rat bladder tumour cells) and Lane 3: PC12 cell lysate (pheochromocytoma of rat adrenal medulla) with ITGA6 polyclonal antibody (Cat # PAB31433).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with ITGA6 polyclonal antibody (Cat # PAB31433) shows strong membranous positivity in trophoblastic cells. -
Gene Info — ITGA6
Entrez GeneID
3655Protein Accession#
P23229Gene Name
ITGA6
Gene Alias
CD49f, DKFZp686J01244, FLJ18737, ITGA6B, VLA-6
Gene Description
integrin, alpha 6
Gene Ontology
HyperlinkGene Summary
The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
integrin alpha chain, alpha 6|integrin alpha6B
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Multiplex flow cytometry barcoding and antibody arrays identify surface antigen profiles of primary and metastatic colon cancer cell lines.
Sukhdeo K, Paramban RI, Vidal JG, Elia J, Martin J, Rivera M, Carrasco DR, Jarrar A, Kalady MF, Carson CT, Balderas R, Hjelmeland AB, Lathia JD, Rich JN.
PLoS One 2013 Jan; 8(1):e53015.
Application:IF, IHC-Fr, IHC-P, Human, Human colon cancer.
-
Identification of integrins alpha6 and beta7 as c-Jun- and transformation-relevant genes in highly invasive fibrosarcoma cells.
Kielosto M, Nummela P, Järvinen K, Yin M, Hölttä E.
International Journal of Cancer 2009 Sep; 125(5):1065.
Application:Flow Cyt, IF, IHC, IP, WB-Tr, Human, Mouse, Amdc cells, HT-1080, NIH/3T3 cells.
-
Multiplex flow cytometry barcoding and antibody arrays identify surface antigen profiles of primary and metastatic colon cancer cell lines.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com