MCL1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human MCL1.
Immunogen
Recombinant protein corresponding to human MCL1.
Sequence
DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of NTERA-2 cell lysate with MCL1 polyclonal antibody (Cat # PAB31403).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with MCL1 polyclonal antibody (Cat # PAB31403) shows strong cytoplasmic positivity in reaction center cells. -
Gene Info — MCL1
Entrez GeneID
4170Protein Accession#
Q07820Gene Name
MCL1
Gene Alias
BCL2L3, EAT, MCL1L, MCL1S, MGC104264, MGC1839, TM
Gene Description
myeloid cell leukemia sequence 1 (BCL2-related)
Omim ID
159552Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the Bcl-2 family. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. The longer gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene product (isoform 2) promotes apoptosis and is death-inducing. [provided by RefSeq
Other Designations
OTTHUMP00000032794|OTTHUMP00000032795|induced myeloid leukemia cell differentiation protein Mcl-1|myeloid cell leukemia sequence 1|myeloid cell leukemia sequence 1, isoform 1
-
Interactome
-
Disease
-
Publication Reference
-
Global variability in gene expression and alternative splicing is modulated by mitochondrial content.
Guantes R, Rastrojo A, Neves R, Lima A, Aguado B, Iborra FJ.
Genome Research 2015 May; 25(5):633.
Application:IF, Human, HeLa cells.
-
Targeting Bcl-2/Bcl-XL induces antitumor activity in uveal melanoma patient-derived xenografts.
Nemati F, de Montrion C, Lang G, Kraus-Berthier L, Carita G, Sastre-Garau X, Berniard A, Vallerand D, Geneste O, de Plater L, Pierré A, Lockhart B, Desjardins L, Piperno-Neumann S, Depil S, Decaudin D.
PLoS One 2014 Jan; 9(1):e80836.
Application:IHC-P, Mouse, Mouse tumors.
-
The synergism of MCL1 and glycolysis on pediatric acute lymphoblastic leukemia cell survival and prednisolone resistance.
Ariës IM, Hansen BR, Koch T, van den Dungen R, Evans WE, Pieters R, den Boer ML.
Haematologica 2013 Dec; 98(12):1905.
Application:Array, WB, Human, Human leukemic cells.
-
Global variability in gene expression and alternative splicing is modulated by mitochondrial content.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com