ECH1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ECH1.
Immunogen
Recombinant protein corresponding to human ECH1.
Sequence
EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTF
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumour cells) with ECH1 polyclonal antibody (Cat # PAB31369).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with ECH1 polyclonal antibody (Cat # PAB31369) shows strong cytoplasmic immunoreactivity in neurons. -
Gene Info — ECH1
Entrez GeneID
1891Protein Accession#
Q13011Gene Name
ECH1
Gene Alias
HPXEL
Gene Description
enoyl Coenzyme A hydratase 1, peroxisomal
Omim ID
600696Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators. [provided by RefSeq
Other Designations
delta3,5-delta2,4-dienoyl-CoA isomerase|dienoyl-CoA isomerase|peroxisomal enoyl-CoA hydratase 1|peroxisomal enoyl-coenzyme A hydratase-like protein
-
Interactome
-
Pathway
-
Publication Reference
-
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E.
Journal of Proteomics 2012 Apr; 75(7):2236.
-
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Bjorling E, Jonasson K, Wernerus H, Hober S, Hokfelt T, Uhlen M.
Molecular & Cellular Proteomics 2009 Jul; 8(7):1612.
Application:IF, IHC-Fr, WB-Ti, Rat, Rat brain.
-
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com