ZIC1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with ZIC1 polyclonal antibody (Cat # PAB30667).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with ZIC1 polyclonal antibody (Cat # PAB30667) shows strong nuclear positivity in neuronal and glial cells.
Immunofluorescence
Immunofluorescent staining of U-2 OS with ZIC1 polyclonal antibody (Cat # PAB30667) (Green) shows positivity in nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ZIC1.
Immunogen
Recombinant protein corresponding to human ZIC1.
Sequence
LGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFNSTRDFLFRNRGFGDAAAAASAQHSLFAASAGGFGGPHGHTDAAGHLLFPGLHEQA
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with ZIC1 polyclonal antibody (Cat # PAB30667).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with ZIC1 polyclonal antibody (Cat # PAB30667) shows strong nuclear positivity in neuronal and glial cells.Immunofluorescence
Immunofluorescent staining of U-2 OS with ZIC1 polyclonal antibody (Cat # PAB30667) (Green) shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — ZIC1
Entrez GeneID
7545Protein Accession#
Q15915Gene Name
ZIC1
Gene Alias
ZIC, ZNF201
Gene Description
Zic family member 1 (odd-paired homolog, Drosophila)
Omim ID
600470Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene. [provided by RefSeq
Other Designations
Zic family member 1 (odd-paired Drosophila homolog)|Zinc finger protein of the cerebellum 1|zinc finger protein of the cerebellum 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com