DPP8 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human DPP8.
Immunogen
Recombinant protein corresponding to amino acids 17-135 of human DPP8.
Sequence
MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis with DPP8 polyclonal antibody (Cat # PAB30561).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG spImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with DPP8 polyclonal antibody (Cat # PAB30561) shows strong cytoplasmic and membranous positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with DPP8 polyclonal antibody (Cat # PAB30561) shows positivity in cytoplasm. Antibody staining is shown in green. -
Gene Info — DPP8
Entrez GeneID
54878Protein Accession#
Q6V1X1Gene Name
DPP8
Gene Alias
DP8, DPRP1, FLJ14920, FLJ20283, MGC26191, MSTP141
Gene Description
dipeptidyl-peptidase 8
Omim ID
606819Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
dipeptidyl peptidase 8|dipeptidyl peptidase IV-related protein-1|dipeptidyl peptidase VIII|dipeptidylpeptidase 8|prolyl dipeptidase DPP8
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com