DPP8 monoclonal antibody (M01), clone 1B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DPP8 is 0.3 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DPP8.
Immunogen
DPP8 (NP_932065.1, 161 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DPP8 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — DPP8
Entrez GeneID
54878GeneBank Accession#
NM_197961Protein Accession#
NP_932065.1Gene Name
DPP8
Gene Alias
DP8, DPRP1, FLJ14920, FLJ20283, MGC26191, MSTP141
Gene Description
dipeptidyl-peptidase 8
Omim ID
606819Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
dipeptidyl peptidase 8|dipeptidyl peptidase IV-related protein-1|dipeptidyl peptidase VIII|dipeptidylpeptidase 8|prolyl dipeptidase DPP8
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com