S100A10 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp with S100A10 polyclonal antibody (Cat # PAB29397) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human small intestine with S100A10 polyclonal antibody (Cat # PAB29397) shows strong cytoplasmic and membranous positivity in glandular cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with S100A10 polyclonal antibody (Cat # PAB29397) at 1-4 ug/mL concentration shows positivity in mitochondria.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human S100A10.
Immunogen
Recombinant protein corresponding to human S100A10.
Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG sp with S100A10 polyclonal antibody (Cat # PAB29397) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human small intestine with S100A10 polyclonal antibody (Cat # PAB29397) shows strong cytoplasmic and membranous positivity in glandular cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with S100A10 polyclonal antibody (Cat # PAB29397) at 1-4 ug/mL concentration shows positivity in mitochondria. -
Gene Info — S100A10
Entrez GeneID
6281Gene Name
S100A10
Gene Alias
42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, MGC111133, P11, p10
Gene Description
S100 calcium binding protein A10
Omim ID
114085Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis. [provided by RefSeq
Other Designations
OTTHUMP00000015269|OTTHUMP00000015270|S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11))|S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11))|annexin II ligand, calpactin I, lig
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com