Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC16A1 polyclonal antibody

  • Catalog # : PAB29395
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human SLC16A1.
  • Immunogen:
  • Recombinant protein corresponding to human SLC16A1.
  • Sequence:
  • PTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (1:500-1:1000)
    Immunofluorescence (1-4 ug/mL)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Human cell line RT-4 with SLC16A1 polyclonal antibody (Cat # PAB29395) at 1:100-1:250 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining of human colon with SLC16A1 polyclonal antibody (Cat # PAB29395) shows strong cytoplasmic and membranous positivity in glandular cells at 1:500-1:1000 dilution.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line U-251 MG with SLC16A1 polyclonal antibody (Cat # PAB29395) at 1-4 ug/mL concentration shows positivity in plasma membrane.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6566
  • Gene Name:
  • SLC16A1
  • Gene Alias:
  • FLJ36745,HHF7,MCT,MCT1,MGC44475
  • Gene Description:
  • solute carrier family 16, member 1 (monocarboxylic acid transporter 1)
  • Gene Summary:
  • The SLC16A1 gene encodes a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes Import and export of these substrates by tissues such as erythrocytes, muscle, intestine, and kidney are ascribed largely to the action of a proton-coupled MCT (Garcia et al., 1994 [PubMed 8124722]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000013960,monocarboxylate transporter 1,solute carrier family 16 (monocarboxylic acid transporters), member 1,solute carrier family 16, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook