RPS6KA3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with RPS6KA3 polyclonal antibody (Cat # PAB29387) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human colon with RPS6KA3 polyclonal antibody (Cat # PAB29387) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with RPS6KA3 polyclonal antibody (Cat # PAB29387) at 1-4 ug/mL concentration shows positivity in nucleus and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human RPS6KA3.
Immunogen
Recombinant protein corresponding to human RPS6KA3.
Sequence
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with RPS6KA3 polyclonal antibody (Cat # PAB29387) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human colon with RPS6KA3 polyclonal antibody (Cat # PAB29387) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with RPS6KA3 polyclonal antibody (Cat # PAB29387) at 1-4 ug/mL concentration shows positivity in nucleus and cytoplasm. -
Gene Info — RPS6KA3
Entrez GeneID
6197Gene Name
RPS6KA3
Gene Alias
CLS, HU-3, ISPK-1, MAPKAPK1B, MRX19, RSK, RSK2, S6K-alpha3, p90-RSK2, pp90RSK2
Gene Description
ribosomal protein S6 kinase, 90kDa, polypeptide 3
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Mutations in this gene have been associated with Coffin-Lowry syndrome (CLS). [provided by RefSeq
Other Designations
OTTHUMP00000023036|insulin-stimulated protein kinase 1|mental retardation, X-linked 19|ribosomal protein S6 kinase, 90kD, polypeptide 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com