Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF10B (Human) Recombinant Protein BioActive

  • Catalog # : P6423
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF10B (O14763) recombinant protein expressed in E. Coli.
  • Sequence:
  • MESALITQQDLAPQQRVAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 15
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Activity:
  • Determined by its ability to inhibit apoptosis induced by Human sTRAIL/Apo2L in LN-18 cells (human glioblastoma cells).
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 8795
  • Gene Name:
  • TNFRSF10B
  • Gene Alias:
  • CD262,DR5,KILLER,KILLER/DR5,TRAIL-R2,TRAILR2,TRICK2,TRICK2A,TRICK2B,TRICKB,ZTNFR9
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 10b
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Fas-like protein,OTTHUMP00000123492,TNF-related apoptosis-inducing ligand receptor 2,TRAIL receptor 2,apoptosis inducing protein TRICK2A/2B,apoptosis inducing receptor TRAIL-R2,cytotoxic TRAIL receptor-2,death domain containing receptor for TRAIL/Apo-2L,d
  • RSS
  • YouTube
  • Linkedin
  • Facebook