Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF17 (Human) Recombinant Protein

  • Catalog # : P3590
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF17 (Q02223, 1 a.a. - 54 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 6
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • < 0.1 ng/ug (1 EU/ug)
  • Storage Buffer:
  • Lyophilized from 30% acetonitrile, 0.1% TFA, pH 7.5
  • Storage Instruction:
  • Store at -20°C on dry atmosphere for 2 years.
    After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 608
  • Gene Name:
  • TNFRSF17
  • Gene Alias:
  • BCM,BCMA,CD269
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 17
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. [provided by RefSeq
  • Other Designations:
  • B cell maturation antigen,B-cell maturation factor,OTTHUMP00000160261
  • RSS
  • YouTube
  • Linkedin
  • Facebook