Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SOX9 monoclonal antibody, clone CL0639

  • Catalog # : MAB15643
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human SOX9.
  • Immunogen:
  • Recombinant protein corresponding to human SOX9.
  • Sequence:
  • SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG2a
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Epitope:
  • This antibody binds to an epitope located within the peptide sequence SQRTHIKTEQLSPSH as determined by overlapping synthetic peptides.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of U-251 MG cell lysate with SOX9 monoclonal antibody, clone CL0639 (Cat # MAB15643).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast cancer with SOX9 monoclonal antibody, clone CL0639 (Cat # MAB15643) shows strong nuclear immunoreactivity in tumor cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of U-251 cells with SOX9 monoclonal antibody, clone CL0639 (Cat # MAB15643) (Green) shows specific staining in the nucleoplasm. Microtubule and nuclear probes are visualized in red and blue, respectively (where available).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6662
  • Gene Name:
  • SOX9
  • Gene Alias:
  • CMD1,CMPD1,SRA1
  • Gene Description:
  • SRY (sex determining region Y)-box 9
  • Gene Summary:
  • The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq
  • Other Designations:
  • SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal),SRY (sex-determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal),SRY (sex-determining region Y)-box 9 protein,campomelic dysplasia, autosomal sex-revers
  • RSS
  • YouTube
  • Linkedin
  • Facebook