SOX9 monoclonal antibody, clone CL0639
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of U-251 MG cell lysate with SOX9 monoclonal antibody, clone CL0639 (Cat # MAB15643).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast cancer with SOX9 monoclonal antibody, clone CL0639 (Cat # MAB15643) shows strong nuclear immunoreactivity in tumor cells.
Immunofluorescence
Immunofluorescent staining of U-251 cells with SOX9 monoclonal antibody, clone CL0639 (Cat # MAB15643) (Green) shows specific staining in the nucleoplasm. Microtubule and nuclear probes are visualized in red and blue, respectively (where available).
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human SOX9.
Immunogen
Recombinant protein corresponding to human SOX9.
Epitope
This antibody binds to an epitope located within the peptide sequence SQRTHIKTEQLSPSH as determined by overlapping synthetic peptides.
Sequence
SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
Host
Mouse
Reactivity
Human, Mouse
Form
Liquid
Purification
Protein A purification
Isotype
IgG2a
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of U-251 MG cell lysate with SOX9 monoclonal antibody, clone CL0639 (Cat # MAB15643).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast cancer with SOX9 monoclonal antibody, clone CL0639 (Cat # MAB15643) shows strong nuclear immunoreactivity in tumor cells.Immunofluorescence
Immunofluorescent staining of U-251 cells with SOX9 monoclonal antibody, clone CL0639 (Cat # MAB15643) (Green) shows specific staining in the nucleoplasm. Microtubule and nuclear probes are visualized in red and blue, respectively (where available). -
Gene Info — SOX9
Entrez GeneID
6662Protein Accession#
P48436Gene Name
SOX9
Gene Alias
CMD1, CMPD1, SRA1
Gene Description
SRY (sex determining region Y)-box 9
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq
Other Designations
SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 protein|campomelic dysplasia, autosomal sex-revers
-
Interactome
-
Disease
-
Publication Reference
-
LETM1 is a potential cancer stem-like cell marker and predicts poor prognosis in colorectal adenocarcinoma.
Piao L, Feng Y, Yang Z, Qi W, Li H, Han H, Xuan Y.
Pathology, Research and Practice 2019 Jul; 215(7):152437.
Application：Func, Human, Human plasma.
-
LETM1 is a potential cancer stem-like cell marker and predicts poor prognosis in colorectal adenocarcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com