SOX9 monoclonal antibody (M02J), clone 3C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SOX9 monoclonal antibody (M02J), clone 3C10. Western Blot analysis of SOX9 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M02J), clone 3C10.
Lane 1: SOX9 transfected lysate (Predicted MW: 56.1 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.7 ug/ml]
Immunoprecipitation
Immunoprecipitation of SOX9 transfected lysate using anti-SOX9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SOX9 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SOX9 is 3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SOX9.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SOX9 monoclonal antibody (M02J), clone 3C10. Western Blot analysis of SOX9 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M02J), clone 3C10.
Lane 1: SOX9 transfected lysate (Predicted MW: 56.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.7 ug/ml]Immunoprecipitation
Immunoprecipitation of SOX9 transfected lysate using anti-SOX9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SOX9 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SOX9 is 3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell . [antibody concentration 10 ug/ml] -
Gene Info — SOX9
Entrez GeneID
6662GeneBank Accession#
NM_000346Protein Accession#
NP_000337Gene Name
SOX9
Gene Alias
CMD1, CMPD1, SRA1
Gene Description
SRY (sex determining region Y)-box 9
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq
Other Designations
SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 protein|campomelic dysplasia, autosomal sex-revers
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com