ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ATP6V1G3 protein.
Immunogen
ATP6V1G3 (NP_573569.1, 1 a.a. ~ 118 a.a) full-length human protein.
Sequence
MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ATP6V1G3 expression in transfected 293T cell line (H00127124-T01) by ATP6V1G3 MaxPab polyclonal antibody.
Lane 1: ATP6V1G3 transfected lysate(12.98 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ATP6V1G3
Entrez GeneID
127124GeneBank Accession#
NM_133262.2Protein Accession#
NP_573569.1Gene Name
ATP6V1G3
Gene Alias
ATP6G3, MGC119810, MGC119813, Vma10
Gene Description
ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
Gene Ontology
HyperlinkGene Summary
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal (vacuolar proton pump) subunit G3|ATPase, H+ transporting, lysosomal 13kD, V1 subunit G|ATPase, H+ transporting, lysosomal, V1 subunit G3|OTTHUMP00000033686|V-ATPase 13 kDa subunit 3|V-ATPase G subunit 3|V-ATPase G3 subu
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com