HOP monoclonal antibody (M01), clone 3D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOP is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.77 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HOP.
Immunogen
HOP (AAH14225, 1 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.77 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOP is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — HOPX
Entrez GeneID
84525GeneBank Accession#
BC014225Protein Accession#
AAH14225Gene Name
HOPX
Gene Alias
Cameo, HOP, LAGY, MGC20820, NECC1, OB1, SMAP31, Toto
Gene Description
HOP homeobox
Omim ID
607275Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000158970|heart odd homeobox 1 protein|homeodomain-only protein|lung cancer-associated Y protein|not expressed in choriocarcinoma clone 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com