HOP MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HOP protein.
Immunogen
HOP (AAH14225.1, 1 a.a. ~ 73 a.a) full-length human protein.
Sequence
MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HOPX expression in transfected 293T cell line (H00084525-T02) by HOPX MaxPab polyclonal antibody.
Lane 1: HOP transfected lysate(8.03 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HOPX
Entrez GeneID
84525GeneBank Accession#
BC014225.2Protein Accession#
AAH14225.1Gene Name
HOPX
Gene Alias
Cameo, HOP, LAGY, MGC20820, NECC1, OB1, SMAP31, Toto
Gene Description
HOP homeobox
Omim ID
607275Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000158970|heart odd homeobox 1 protein|homeodomain-only protein|lung cancer-associated Y protein|not expressed in choriocarcinoma clone 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com