DNASE2B polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant DNASE2B.
Immunogen
DNASE2B (NP_067056, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag.
Sequence
HLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (67)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — DNASE2B
Entrez GeneID
58511GeneBank Accession#
NM_021233Protein Accession#
NP_067056Gene Name
DNASE2B
Gene Alias
DLAD
Gene Description
deoxyribonuclease II beta
Omim ID
608057Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
DNase II-like acid DNase|OTTHUMP00000011481|endonuclease DLAD|lysosomal DNase II
-
Interactome
-
Pathway
-
Publication Reference
-
Coordinated and sequential activation of neutral and acidic DNases during interdigital cell death in the embryonic limb.
Montero JA, Lorda-Diez CI, Certal AC, Moreno N, Rodriguez-Leon J, Torriglia A, Hurle JM.
Apoptosis 2010 Oct; 15(10):1197.
Application：IF, Chicken, Mesenchymal cells.
-
Coordinated and sequential activation of neutral and acidic DNases during interdigital cell death in the embryonic limb.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com