Product Browser

Last updated: 2017/4/23
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DIABLO purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00056616-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human DIABLO protein.
  • Immunogen:
  • DIABLO (NP_063940.1, 1 a.a. ~ 239 a.a) full-length human protein.
  • Sequence:
  • MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DIABLO expression in transfected 293T cell line (H00056616-T01) by DIABLO MaxPab polyclonal antibody.

    Lane 1: DIABLO transfected lysate(27.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • DIABLO
  • Gene Alias:
  • DIABLO-S,FLJ10537,FLJ25049,SMAC,SMAC3
  • Gene Description:
  • diablo homolog (Drosophila)
  • Gene Summary:
  • This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and it moderates the caspase inhibition of IAPs. Multiple polyadenylation sites have been found for this gene. Four alternatively spliced transcript variants have been described for this gene, with two of them encoding different isoforms and the other two probably not encoding a protein. [provided by RefSeq
  • Other Designations:
  • 0610041G12Rik,diablo,direct IAP-binding protein with low pI,mitochondrial Smac protein,second mitochondria-derived activator of caspase
  • RSS
  • YouTube
  • Linkedin
  • Facebook