SIRT6 monoclonal antibody (M01), clone 1D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SIRT6.
Immunogen
SIRT6 (NP_057623.1, 141 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIRT6 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — SIRT6
Entrez GeneID
51548GeneBank Accession#
NM_016539Protein Accession#
NP_057623.1Gene Name
SIRT6
Gene Alias
SIR2L6
Gene Description
sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae)
Omim ID
606211Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family. [provided by RefSeq
Other Designations
sir2-related protein type 6|sirtuin 6|sirtuin type 6
-
Interactome
-
Publication Reference
-
SIRT6 expression is associated with poor prognosis and chemosensitivity in patients with non-small cell lung cancer.
Azuma Y, Yokobori T, Mogi A, Altan B, Yajima T, Kosaka T, Onozato R, Yamaki E, Asao T, Nishiyama M, Kuwano H.
Journal of Surgical Oncology 2015 Aug; 112(2):231.
Application:IHC, Human, Lung cancer tumor.
-
Over expression of wild type or a catalytically dead mutant of Sirtuin 6 does not influence NFκB responses.
Grimley R, Polyakova O, Vamathevan J, McKenary J, Hayes B, Patel C, Smith J, Bridges A, Fosberry A, Bhardwaja A, Mouzon B, Chung CW, Barrett N, Richmond N, Modha S, Solari R.
PLoS One 2012 Jul; 7(7):e39847.
Application:WB-Tr, Human, HEK 293 cells.
-
SIRT6 expression is associated with poor prognosis and chemosensitivity in patients with non-small cell lung cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com