UBE2T purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of UBE2T expression in transfected 293T cell line (H00029089-T02) by UBE2T MaxPab polyclonal antibody.
Lane 1: UBE2T transfected lysate(22.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human UBE2T protein.
Immunogen
UBE2T (NP_054895.1, 1 a.a. ~ 197 a.a) full-length human protein.
Sequence
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (82)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UBE2T expression in transfected 293T cell line (H00029089-T02) by UBE2T MaxPab polyclonal antibody.
Lane 1: UBE2T transfected lysate(22.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — UBE2T
Entrez GeneID
29089GeneBank Accession#
NM_014176.1Protein Accession#
NP_054895.1Gene Name
UBE2T
Gene Alias
HSPC150, PIG50
Gene Description
ubiquitin-conjugating enzyme E2T (putative)
Omim ID
610538Gene Ontology
HyperlinkGene Summary
The covalent conjugation of ubiquitin to proteins regulates diverse cellular pathways and proteins. Ubiquitin is transferred to a target protein through a concerted action of a ubiquitin-activating enzyme (E1), a ubiquitin-conjugating enzyme (E2), such as UBE2T, and a ubiquitin ligase (E3) (Machida et al., 2006 [PubMed 16916645]).[supplied by OMIM
Other Designations
HSPC150 protein similar to ubiquitin-conjugating enzyme|OTTHUMP00000038808|ubiquitin conjugating enzyme
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com