UBE2T monoclonal antibody (M01), clone 1E12-4A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant UBE2T.
Immunogen
UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (82)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UBE2T monoclonal antibody (M01), clone 1E12-4A3 Western Blot analysis of UBE2T expression in Hela ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of UBE2T transfected lysate using anti-UBE2T monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UBE2T MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — UBE2T
Entrez GeneID
29089GeneBank Accession#
BC004152Protein Accession#
AAH04152Gene Name
UBE2T
Gene Alias
HSPC150, PIG50
Gene Description
ubiquitin-conjugating enzyme E2T (putative)
Omim ID
610538Gene Ontology
HyperlinkGene Summary
The covalent conjugation of ubiquitin to proteins regulates diverse cellular pathways and proteins. Ubiquitin is transferred to a target protein through a concerted action of a ubiquitin-activating enzyme (E1), a ubiquitin-conjugating enzyme (E2), such as UBE2T, and a ubiquitin ligase (E3) (Machida et al., 2006 [PubMed 16916645]).[supplied by OMIM
Other Designations
HSPC150 protein similar to ubiquitin-conjugating enzyme|OTTHUMP00000038808|ubiquitin conjugating enzyme
-
Interactome
-
Publication Reference
-
Hypoxia disrupts the Fanconi anemia pathway and sensitizes cells to chemotherapy through regulation of UBE2T.
Ramaekers CH, van den Beucken T, Meng A, Kassam S, Thoms J, Bristow RG, Wouters BG.
Radiotherapy and Oncology 2011 Oct; 101(1):190.
Application:WB-Ce, WB-Tr, Human, MCF7, HeLa cells.
-
Hypoxia disrupts the Fanconi anemia pathway and sensitizes cells to chemotherapy through regulation of UBE2T.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com