Product Browser

Last updated: 2017/2/26
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CBX3 monoclonal antibody (M02A), clone S3

  • Catalog # : H00011335-M02A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant CBX3.
  • Immunogen:
  • CBX3 (AAH00954, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMLLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011335-M02A
    Western Blot detection against Immunogen (45.87 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CBX3
  • Gene Alias:
  • HECH,HP1-GAMMA,HP1Hs-gamma
  • Gene Description:
  • chromobox homolog 3 (HP1 gamma homolog, Drosophila)
  • Gene Summary:
  • At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • HP1 gamma homolog,OTTHUMP00000024529,OTTHUMP00000122519,chromobox homolog 3,heterochromatin protein HP1 gamma,heterochromatin-like protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook