Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BATF purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00010538-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human BATF protein.
  • Immunogen:
  • BATF (NP_006390.1, 1 a.a. ~ 125 a.a) full-length human protein.
  • Sequence:
  • MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BATF expression in transfected 293T cell line (H00010538-T02) by BATF MaxPab polyclonal antibody.

    Lane 1: BATF transfected lysate(14.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • BATF
  • Gene Alias:
  • B-ATF,BATF1,SFA-2,SFA2
  • Gene Description:
  • basic leucine zipper transcription factor, ATF-like
  • Gene Summary:
  • The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq
  • Other Designations:
  • SF-HT-activated gene 2,activating transcription factor B
  • RSS
  • YouTube
  • Linkedin
  • Facebook