BATF monoclonal antibody (M03), clone 1G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BATF.
Immunogen
BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.86 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BATF monoclonal antibody (M03), clone 1G4 Western Blot analysis of BATF expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
BATF monoclonal antibody (M03), clone 1G4. Western Blot analysis of BATF expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
BATF monoclonal antibody (M03), clone 1G4. Western Blot analysis of BATF expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody (M03), clone 1G4.
Lane 1: BATF transfected lysate(14.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BATF is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — BATF
Entrez GeneID
10538GeneBank Accession#
NM_006399Protein Accession#
NP_006390Gene Name
BATF
Gene Alias
B-ATF, BATF1, SFA-2, SFA2
Gene Description
basic leucine zipper transcription factor, ATF-like
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq
Other Designations
SF-HT-activated gene 2|activating transcription factor B
-
Interactome
-
Publication Reference
-
A differentiation checkpoint limits hematopoietic stem cell self-renewal in response to DNA damage.
Wang J, Sun Q, Morita Y, Jiang H, Gross A, Lechel A, Hildner K, Guachalla LM, Gompf A, Hartmann D, Schambach A, Wuestefeld T, Dauch D, Schrezenmeier H, Hofmann WK, Nakauchi H, Ju Z, Kestler HA, Zender L, Rudolph KL.
Cell 2012 Mar; 148(5):1001.
Application:WB-Ce, WB-Tr, Mouse, Hematopoietic stem cells, HSCs.
-
A differentiation checkpoint limits hematopoietic stem cell self-renewal in response to DNA damage.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com