PIAS3 monoclonal antibody (M03), clone 4F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PIAS3.
Immunogen
PIAS3 (NP_006090, 453 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PIAS3 expression in transfected 293T cell line by PIAS3 monoclonal antibody (M03), clone 4F12.
Lane 1: PIAS3 transfected lysate(67 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PIAS3 over-expressed 293 cell line, cotransfected with PIAS3 Validated Chimera RNAi ( Cat # H00010401-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PIAS3 monoclonal antibody (M03), clone 4F12 (Cat # H00010401-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PIAS3
Entrez GeneID
10401GeneBank Accession#
NM_006099Protein Accession#
NP_006090Gene Name
PIAS3
Gene Alias
FLJ14651, ZMIZ5
Gene Description
protein inhibitor of activated STAT, 3
Omim ID
605987Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000015586|zinc finger, MIZ-type containing 5
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com