TRIM28 monoclonal antibody (M01), clone 4E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRIM28.
Immunogen
TRIM28 (AAH04978, 379 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.69 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TRIM28 monoclonal antibody (M01), clone 4E6. Western Blot analysis of TRIM28 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
TRIM28 monoclonal antibody (M01), clone 4E6 Western Blot analysis of TRIM28 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
TRIM28 monoclonal antibody (M01), clone 4E6. Western Blot analysis of TRIM28 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TRIM28 expression in transfected 293T cell line by TRIM28 monoclonal antibody (M01), clone 4E6.
Lane 1: TRIM28 transfected lysate(88.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TRIM28 over-expressed 293 cell line, cotransfected with TRIM28 Validated Chimera RNAi ( Cat # H00010155-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM28 monoclonal antibody (M01) clone 4E6 (Cat # H00010155-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to TRIM28 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TRIM28
Entrez GeneID
10155GeneBank Accession#
BC004978Protein Accession#
AAH04978Gene Name
TRIM28
Gene Alias
FLJ29029, KAP1, RNF96, TF1B, TIF1B
Gene Description
tripartite motif-containing 28
Omim ID
601742Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq
Other Designations
KRAB-associated protein 1|nuclear corepressor KAP-1|transcriptional intermediary factor 1-beta|tripartite motif-containing 28 protein
-
Interactomes
-
Publication Reference
-
Multipotent Adult Germline Stem Cells and Embryonic Stem Cells Functional Proteomics Revealed an Important Role of Eukaryotic Initiation Factor 5A (Eif5a) in Stem Cell Differentiation.
Dihazi H, Dihazi GH, Jahn O, Meyer S, Nolte J, Asif AR, Mueller GA, Engel W.
Journal of Proteome Research 2011 Apr; 10(4):1962.
Application:WB, Human, Multipotent adult germline stem cells(maGSC), Embryonic stem cells (ESCs).
-
Multipotent Adult Germline Stem Cells and Embryonic Stem Cells Functional Proteomics Revealed an Important Role of Eukaryotic Initiation Factor 5A (Eif5a) in Stem Cell Differentiation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com