TRIM28 monoclonal antibody (M02), clone 1D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRIM28.
Immunogen
TRIM28 (AAH04978, 379 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.69 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in MCF-7.Western Blot (Cell lysate)
TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TRIM28 expression in transfected 293T cell line by TRIM28 monoclonal antibody (M02), clone 1D11.
Lane 1: TRIM28 transfected lysate (Predicted MW: 88.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — TRIM28
Entrez GeneID
10155GeneBank Accession#
BC004978Protein Accession#
AAH04978Gene Name
TRIM28
Gene Alias
FLJ29029, KAP1, RNF96, TF1B, TIF1B
Gene Description
tripartite motif-containing 28
Omim ID
601742Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq
Other Designations
KRAB-associated protein 1|nuclear corepressor KAP-1|transcriptional intermediary factor 1-beta|tripartite motif-containing 28 protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com