G3BP1 monoclonal antibody (M01J), clone 2F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
G3BP1 monoclonal antibody (M01J), clone 2F3. Western Blot analysis of G3BP1 expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of G3BP1 expression in transfected 293T cell line by G3BP1 monoclonal antibody (M01J), clone 2F3.
Lane 1: G3BP1 transfected lysate (Predicted MW: 52.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to G3BP1 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged G3BP1 is 0.3 ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of G3BP over-expressed 293 cell line, cotransfected with G3BP Validated Chimera RNAi ( Cat # H00010146-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with G3BP monoclonal antibody (M01), clone 2F3 (Cat # H00010146-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to G3BP1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant G3BP1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
G3BP1 (AAH06997, 214 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
G3BP1 monoclonal antibody (M01J), clone 2F3. Western Blot analysis of G3BP1 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of G3BP1 expression in transfected 293T cell line by G3BP1 monoclonal antibody (M01J), clone 2F3.
Lane 1: G3BP1 transfected lysate (Predicted MW: 52.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to G3BP1 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged G3BP1 is 0.3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of G3BP over-expressed 293 cell line, cotransfected with G3BP Validated Chimera RNAi ( Cat # H00010146-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with G3BP monoclonal antibody (M01), clone 2F3 (Cat # H00010146-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to G3BP1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — G3BP1
Entrez GeneID
10146GeneBank Accession#
BC006997Protein Accession#
AAH06997Gene Name
G3BP1
Gene Alias
G3BP, HDH-VIII, MGC111040
Gene Description
GTPase activating protein (SH3 domain) binding protein 1
Omim ID
608431Gene Ontology
HyperlinkGene Summary
This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
GAP binding protein|OTTHUMP00000160618|Ras-GTPase-activating protein SH3-domain-binding protein|RasGAP-associated endoribonuclease G3BP
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com